Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
TXNDC17; TXNL5Thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; TRP14; Protein 42-9-9; Thioredoxin-like protein 5
Species
Homo sapiens (Human)
Expression Region
1-123aa
Target Protein Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human TXNDC17 was expressed with the amino acid range of 1-123. This TXNDC17 protein is theoretically predicted to have a molecular weight of 40.9 kDa. The TXNDC17 protein was expressed in e.coli. The N-terminal GST tag was smoothly integrated into the coding gene of TXNDC17, which enables a simple process of detecting and purifying the TXNDC17 recombinant protein in the following steps.
Thioredoxin domain-containing protein 17 (TXNDC17), also known as TRP14, is a highly conserved and ubiquitously expressed oxidoreductase. It is involved in maintaining cellular redox homeostasis via a thiol-disulfide reductase activity. TXNDC17 is primarily localized to the endoplasmic reticulum (ER), where it participates in disulfide bond formation and is involved in the folding of newly synthesized proteins. Redox regulation within the ER is essential for the proper maturation of proteins that undergo post-translational modifications, including disulfide bond formation, before being transported to their final destinations within or outside the cell.